|
Too long names
|
|
|
Wales (country that is part of the United Kingdom), there is a village called Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (58 letters), which in English means "Saint Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave." The locals call it Llanfairpwll. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word .com domain name in the world. However in October 1999, it became possible to register domain names up to 67 characters in and finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronuku
pokaiwhenuaakitanarahu
Which translates into English as "The brow of the hill where Tamatea, with the bony knees, who slid and climbed mountains, the great travelers, sat and played on the flute to his beloved
This town is in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
In Thailand which is long so long that it doesn't even fit on one line! Meaning the 'City of Angels' (a whopping 163 characters), is known to the locals as Krungthep Mahanakhon. However, it is not recognised by the Guinness Book of Records
However whilst the New Zealand place name is recognised by the Guinness Book of Record, the Thailand name is not |
|
|
|
| |
